General Information

  • ID:  hor006372
  • Uniprot ID:  P01273
  • Protein name:  Glicentin
  • Gene name:  GCG
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0014823 response to activity; GO:0042593 glucose homeostasis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  HSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • Length:  69(21-89)
  • Propeptide:  MKNIYIVAGFFVVLVQGSWQHSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELGRRHADGSFSDEMNTILDSLATRDFINWLIQTKITDKK
  • Signal peptide:  MKNIYIVAGFFVVLVQGSWQ
  • Modification:  T34 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01273-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006372_AF2.pdbhor006372_ESM.pdb

Physical Information

Mass: 935882 Formula: C346H535N107O120S
Absent amino acids: C Common amino acids: DS
pI: 5.66 Basic residues: 12
Polar residues: 21 Hydrophobic residues: 14
Hydrophobicity: -150.72 Boman Index: -27126
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 42.46
Instability Index: 8517.68 Extinction Coefficient cystines: 8480
Absorbance 280nm: 124.71

Literature

  • PubMed ID:  6835407
  • Title:  Hamster preproglucagon contains the sequence of glucagon and two related peptides.
  • PubMed ID:  12554744
  • Title:  Glucagon-like peptides: regulators of cell proliferation, differentiation, and apoptosis.
  • PubMed ID:  12626323
  • Title:  Glucagon and regulation of glucose metabolism.
  • PubMed ID:  10322410
  • Title:  Glucagon-like Peptide 2.
  • PubMed ID:  10605628
  • Title:  The gl